PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 320aa    MW: 36997.2 Da    PI: 6.5629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234393.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1813.1e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_008234393.1   7 VPPGFRFHPTDEELVDYYLRKKVSSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAI 100
                     69****************************.9***************954555442556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_008234393.1 101 YS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-615156IPR003441NAC domain
PROSITE profilePS5100560.1797156IPR003441NAC domain
PfamPF023656.4E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVS SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQEEGWVV CRVFKKKIAS LRIKMNEHES PCWYDDQVSF  180
MPDLDSPNQN SNSNINMAPY HHLPYPCKKE LDHLPAFQFP HEHFFQLPFL GSPKLLQSSA  240
TGVSSSNSMA AHAYSIDINH ACTFQPSDQD QNFHGAVYGN NSNDDHPQAV DQLTDWRMLD  300
KFVASQLSQD DASNKGNSYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234393.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9FWX21e-133NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5X7780.0M5X778_PRUPE; Uncharacterized protein
STRINGVIT_16s0022g00690.t011e-175(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-124NAC 007